Structure of PDB 8fl0 Chain BA

Receptor sequence
>8fl0BA (length=160) Species: 9606 (Homo sapiens) [Search protein sequence]
DPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKG
LRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNIT
FDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDI
NSGAVECPAS
3D structure
PDB8fl0 Principles of human pre-60 S biogenesis.
ChainBA
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BA R16 R57 S76 S78 K96 N97 H100 M116 R119 A122 R123 K130 E131 T135 S138 H149 R11 R52 S71 S73 K91 N92 H95 M111 R114 A117 R118 K125 E126 T130 S133 H144
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fl0, PDBe:8fl0, PDBj:8fl0
PDBsum8fl0
PubMed37410842
UniProtP30050|RL12_HUMAN Large ribosomal subunit protein uL11 (Gene Name=RPL12)

[Back to BioLiP]