Structure of PDB 8evt Chain BA

Receptor sequence

>8evtBA (length=206) Species: 4932 (Saccharomyces cerevisiae)

SLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVG
KTWEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGATPIAGR
FTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDS
PSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDL
YFYRDP

3D structure

• PDB: 8evt Regulation of translation by ribosomal RNA pseudouridylation.
• Chain: BA
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	G	BA	T108 N109	T107 N108
BS02	A	BA	R101 P104 G105 Q131 E135	R100 P103 G104 Q130 E134

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0000054 ribosomal subunit export from nucleus
• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000461 endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0010494 cytoplasmic stress granule
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8evt, PDBe:8evt, PDBj:8evt
• PDBsum: 8evt
• PubMed: 37595043
• UniProt: P32905|RSSA1_YEAST Small ribosomal subunit protein uS2A (Gene Name=RPS0A)