Structure of PDB 7ezx Chain BA

Receptor sequence

>7ezxBA (length=177) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

PDB

7ezx Structure of the phycobilisome from the red alga Porphyridium purpureum in Middle Light

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	BA	N72 C73 R78 A81 C82 R84 D85 I88 Y117 L120 V122 S126 S127	N72 C73 R78 A81 C82 R84 D85 I88 Y117 L120 V122 S126 S127
BS02	PEB	BA	N35 K36 L38 D39 A40 I142 T143 F153 A154 A155 G156 D157 C158	N35 K36 L38 D39 A40 I142 T143 F153 A154 A155 G156 D157 C158
BS03	PEB	BA	C50 D54 S57 G58 C61 R129 S132 I133 A136 Q137 F141 T147	C50 D54 S57 G58 C61 R129 S132 I133 A136 Q137 F141 T147

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ezx, PDBe:7ezx, PDBj:7ezx
PDBsum	7ezx
PubMed
UniProt	P11393\|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]