Structure of PDB 7nqh Chain B9

Receptor sequence
>7nqhB9 (length=38) Species: 9823 (Sus scrofa) [Search protein sequence]
FKTKGVLKKRCRDCYLVKRRGRWFIYCKTNPKHKQRQM
3D structure
PDB7nqh Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
ChainB9
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B9 F63 K64 K66 G67 V68 L69 K70 K71 R72 R74 L78 K80 R81 R82 G83 W85 Y88 P93 K94 K96 M100 F1 K2 K4 G5 V6 L7 K8 K9 R10 R12 L16 K18 R19 R20 G21 W23 Y26 P31 K32 K34 M38
BS02 ZN B9 C73 C89 H95 C11 C27 H33
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005739 mitochondrion
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0016604 nuclear body
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nqh, PDBe:7nqh, PDBj:7nqh
PDBsum7nqh
PubMed33878294
UniProtA0A287A731

[Back to BioLiP]