Structure of PDB 6qc8 Chain B9

Receptor sequence
>6qc8B9 (length=176) Species: 9940 (Ovis aries) [Search protein sequence]
FLPSAAYLTHQQKVLQLYKRALRHLESRCVHRDKYRYFACLLRARFDEHK
NEKDMVKATQLLREAEKEFWHGQHPQPYIFPESPGGTSYERYECYKVPEW
CLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQEETPVGGPRTE
ALPPARKQGDLPPLWWHIVTRPRERP
3D structure
PDB6qc8 Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.
ChainB9
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZMP B9 Q12 R46 F47 H50 K51 A66 E69 Q11 R45 F46 H49 K50 A65 E68
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 14:37:01 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6qc8', asym_id = 'B9', title = 'Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6qc8', asym_id='B9', title='Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006120', uniprot = '', pdbid = '6qc8', asym_id = 'B9'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006120', uniprot='', pdbid='6qc8', asym_id='B9')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>