Structure of PDB 6c5l Chain B9

Receptor sequence
>6c5lB9 (length=36) Species: 274 (Thermus thermophilus) [Search protein sequence]
KVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG
3D structure
PDB6c5l Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
ChainB9
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B9 R4 A5 S6 V7 K8 K15 V16 I17 R18 R19 H20 P30 K31 K33 R35 Q36 G37 R3 A4 S5 V6 K7 K14 V15 I16 R17 R18 H19 P29 K30 K32 R34 Q35 G36
BS02 ZN B9 C11 H32 C10 H31
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c5l, PDBe:6c5l, PDBj:6c5l
PDBsum6c5l
PubMed29403017
UniProtQ5SHR2|RL36_THET8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]