Structure of PDB 4v8i Chain B9

Receptor sequence
>4v8iB9 (length=36) Species: 274 (Thermus thermophilus) [Search protein sequence]
KVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG
3D structure
PDB4v8i How hibernation factors RMF, HPF, and YfiA turn off protein synthesis.
ChainB9
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B9 K2 R4 A5 S6 V7 R9 K15 V16 R18 R19 H20 R22 P30 K31 K33 R35 Q36 G37 K1 R3 A4 S5 V6 R8 K14 V15 R17 R18 H19 R21 P29 K30 K32 R34 Q35 G36
BS02 ZN B9 C11 C14 C27 H32 C10 C13 C26 H31
BS03 MG B9 K2 R35 K1 R34
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8i, PDBe:4v8i, PDBj:4v8i
PDBsum4v8i
PubMed22605777
UniProtP80256|RL36_THETH Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]