Structure of PDB 4v68 Chain B9

Receptor sequence
>4v68B9 (length=35) Species: 274 (Thermus thermophilus) [Search protein sequence]
KVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQ
3D structure
PDB4v68 GTPase activation of elongation factor EF-Tu by the ribosome during decoding
ChainB9
Resolution6.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B9 K2 R4 A5 S6 V7 K8 I10 R18 R19 H20 R22 Y24 P30 K31 K33 R35 Q36 K1 R3 A4 S5 V6 K7 I9 R17 R18 H19 R21 Y23 P29 K30 K32 R34 Q35
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v68, PDBe:4v68, PDBj:4v68
PDBsum4v68
PubMed19229291
UniProtQ72I28|RL36_THET2 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]