Structure of PDB 6lqp Chain B8

Receptor sequence

>6lqpB8 (length=477) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

PPPDEEEQLLAKFVFGDTTDLQENLAKFNADFEAAWIDSDDEKIKVPILV
TNKTKKLRTSYNESKINGVHYINRLRSQFEKIYPRPKWVDDESDINALTK
ILSTTYNYKDTLSNSKLLPPKKLDIVRLKDANASHPSHSAIQSLSFHPSK
PLLLTGGYDKTLRIYHIDGKTNHLVTSLHLVGSPIQTCTFYTSLSNQNQQ
NIFTAGRRRYMHSWDLSLTAKIEKFSRLYGHESTQRSFENFKVAHLQNSQ
TNSVHGIVLLQGNNGWINILHSTSGLWLMGCKIEGVITDFCIDYQPISRG
KFRTILIAVNAYGEVWEFDLNKNGHVIRRWKDQGGVGITKIQVGGGTTTT
CPALQISKIKQNRWLAVGSESGFVNLYDRNNAMTSSTPTPVAALDQLTTT
ISNLQFSPDGQILCMASRAVKDALRLVHLPSCSVFSNWPTSGTPLGKVTS
VAFSPSGGLLAVGNEQGKVRLWKLNHY

3D structure

PDB

6lqp Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B8	K231 Q513 R542 S553	K121 Q396 R425 S436
BS02	rna	B8	N141 K142 K144 K145 R147 Y150 Q167 D234 V236 R237 Q252 R317 R318 R319 Y320 K341 S343 R344 R353 S354 N380 R535 A536 K538 D539 N554 W555 T557 S558 G559 T560 P561 G563 K564 Q583	N52 K53 K55 K56 R58 Y61 Q78 D124 V126 R127 Q142 R207 R208 R209 Y210 K224 S226 R227 R236 S237 N263 R418 A419 K421 D422 N437 W438 T440 S441 G442 T443 P444 G446 K447 Q466

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0005515	protein binding

	Biological Process
GO:0000292	RNA fragment catabolic process
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364	rRNA processing
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0030686	90S preribosome
GO:0032040	small-subunit processome
GO:0034388	Pwp2p-containing subcomplex of 90S preribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6lqp, PDBe:6lqp, PDBj:6lqp
PDBsum	6lqp
PubMed	32943522
UniProt	P40362\|UTP18_YEAST U3 small nucleolar RNA-associated protein 18 (Gene Name=UTP18)

[Back to BioLiP]