Structure of PDB 5el6 Chain B8

Receptor sequence
>5el6B8 (length=132) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
NRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIR
IRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLYF
IRNLSDREIRRKLRADRKRIDQDRAAERAAKE
3D structure
PDB5el6 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
ChainB8
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B8 R41 D107 R108 R118 K119 D122 R125 R40 D106 R107 R117 K118 D121 R124
BS02 rna B8 N2 R3 G4 A5 R23 R51 R53 R54 N55 N58 T60 R95 R96 A97 K98 Y100 F101 K113 K119 N1 R2 G3 A4 R22 R50 R52 R53 N54 N57 T59 R94 R95 A96 K97 Y99 F100 K112 K118
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5el6, PDBe:5el6, PDBj:5el6
PDBsum5el6
PubMed26791911
UniProtP60490|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]