Structure of PDB 4v9r Chain B8

Receptor sequence

>4v9rB8 (length=64) Species: 274 (Thermus thermophilus)

PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLPYE

3D structure

• PDB: 4v9r The antibiotics dityromycin and GE82832 bind protein S12 and block EF-G-catalyzed translocation.
• Chain: B8
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B8	P2 K3 M4 K5 T6 H7 K8 K12 R13 K15 T17 S19 K21 K26 T27 G28 K29 R30 H31 N33 W34 Q35 K39 I41 R42 Q43 K44 K47 F48 A51 K52 Y64	P1 K2 M3 K4 T5 H6 K7 K11 R12 K14 T16 S18 K20 K25 T26 G27 K28 R29 H30 N32 W33 Q34 K38 I40 R41 Q42 K43 K46 F47 A50 K51 Y63
BS02	MG	B8	S37 G38	S36 G37

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9r, PDBe:4v9r, PDBj:4v9r
• PDBsum: 4v9r
• PubMed: 24412368
• UniProt: Q5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)