Structure of PDB 4v90 Chain B8

Receptor sequence

>4v90B8 (length=63) Species: 300852 (Thermus thermophilus HB8)

PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLPY

3D structure

• PDB: 4v90 Structure of EF-G-ribosome complex in a pretranslocation state.
• Chain: B8
• Resolution: 2.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B8	P2 K3 M4 K5 T6 H7 K8 K11 K12 R13 K15 T17 A18 S19 K21 K26 T27 G28 K29 R30 H31 L32 N33 W34 K39 I41 R42 Q43 R46 F48 V49 K52 L62 Y64	P1 K2 M3 K4 T5 H6 K7 K10 K11 R12 K14 T16 A17 S18 K20 K25 T26 G27 K28 R29 H30 L31 N32 W33 K38 I40 R41 Q42 R45 F47 V48 K51 L61 Y63

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v90, PDBe:4v90, PDBj:4v90
• PDBsum: 4v90
• PubMed: 23912278
• UniProt: Q5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)