Structure of PDB 4v4z Chain B8

Receptor sequence
>4v4zB8 (length=37) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG
3D structure
PDB4v4z Structural basis for messenger RNA movement on the ribosome.
ChainB8
Resolution4.51 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B8 K2 R4 A5 S6 V7 K8 D12 K15 V16 R18 R19 H20 R22 Y24 P30 K31 K33 R35 Q36 K2 R4 A5 S6 V7 K8 D12 K15 V16 R18 R19 H20 R22 Y24 P30 K31 K33 R35 Q36
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4z, PDBe:4v4z, PDBj:4v4z
PDBsum4v4z
PubMed17051149
UniProtQ5SHR2|RL36_THET8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]