Structure of PDB 4v4s Chain B8

Receptor sequence
>4v4sB8 (length=63) Species: 274 (Thermus thermophilus) [Search protein sequence]
PKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLA
KAEWARMKLMLPR
3D structure
PDB4v4s Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainB8
Resolution6.76 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna B8 P2 K3 M4 K5 H7 K8 K11 R12 R13 T17 T19 F25 S27 G28 K29 R30 H31 Q32 N33 T34 G35 D39 I41 R42 K46 V49 K52 M58 M61 L62 P1 K2 M3 K4 H6 K7 K10 R11 R12 T16 T18 F24 S26 G27 K28 R29 H30 Q31 N32 T33 G34 D38 I40 R41 K45 V48 K51 M57 M60 L61
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v4s, PDBe:4v4s, PDBj:4v4s
PDBsum4v4s
PubMed16377566
UniProtQ9RSW6|RL35_DEIRA Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]