Structure of PDB 5myj Chain B7

Receptor sequence
>5myjB7 (length=64) Species: 416870 (Lactococcus cremoris subsp. cremoris MG1363) [Search protein sequence]
PKQKTHRASAKRFKRTGNGGLKRFRAYTSHRFHGKSVKQRRQLRKASMVS
KGDFKRIRRMVATM
3D structure
PDB5myj A general mechanism of ribosome dimerization revealed by single-particle cryo-electron microscopy.
ChainB7
Resolution5.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B7 P2 K3 Q4 K5 T6 R8 A9 T17 N19 R24 R26 A27 Y28 S30 H31 R32 F33 H34 G35 K36 K39 Q40 R41 R42 R45 M49 D54 R57 R60 M65 P1 K2 Q3 K4 T5 R7 A8 T16 N18 R23 R25 A26 Y27 S29 H30 R31 F32 H33 G34 K35 K38 Q39 R40 R41 R44 M48 D53 R56 R59 M64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5myj, PDBe:5myj, PDBj:5myj
PDBsum5myj
PubMed28959045
UniProtA2RMR2|RL35_LACLM Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]