Structure of PDB 5aj4 Chain B7

Receptor sequence

>5aj4B7 (length=46) Species: 9823 (Sus scrofa) [Search protein sequence]

KARGNEYQPSNIKRKHKHGWVRRLRTPTGVQVILRRMHKGRKSLSH

3D structure

PDB

5aj4 The complete structure of the 55S mammalian mitochondrial ribosome.

Chain

Resolution

3.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B7	K50 A51 R52 G53 N54 E55 Y56 Q57 P58 S59 N60 I61 K62 R63 K64 K66 H67 G68 W69 V70 R71 R72 L73 R74 T77 V81 R84 R85 K88 G89 R90 K91 H95	K1 A2 R3 G4 N5 E6 Y7 Q8 P9 S10 N11 I12 K13 R14 K15 K17 H18 G19 W20 V21 R22 R23 L24 R25 T28 V32 R35 R36 K39 G40 R41 K42 H46

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links