Structure of PDB 4v8k Chain B7

Receptor sequence

>4v8kB7 (length=54) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]

LYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIPVSYQA
LGKK

3D structure

PDB

4v8k Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom

Chain

Resolution

3.006 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CRT	B7	L21 I24 Q28 L31	L14 I17 Q21 L24
BS02	CA	B7	W46 D49 N50	W39 D42 N43
BS03	CRT	B7	L33 H36 M37	L26 H29 M30
BS04	BCL	B7	V25 Q28 I29 G32 H36 W46	V18 Q21 I22 G25 H29 W39
BS05	BCL	B7	G32 I35 H36	G25 I28 H29

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0019866	organelle inner membrane
GO:0030076	light-harvesting complex
GO:0030077	plasma membrane light-harvesting complex

External links