Structure of PDB 4v67 Chain B7

Receptor sequence
>4v67B7 (length=48) Species: 274 (Thermus thermophilus) [Search protein sequence]
MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRK
3D structure
PDB4v67 Crystal structure of a translation termination complex formed with release factor RF2.
ChainB7
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B7 M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 K14 H16 G17 F18 R19 R21 M22 K29 V30 K32 R33 R34 R35 Q36 K37 G38 R39 W40 R41 R47 K48 M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 K14 H16 G17 F18 R19 R21 M22 K29 V30 K32 R33 R34 R35 Q36 K37 G38 R39 W40 R41 R47 K48
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v67, PDBe:4v67, PDBj:4v67
PDBsum4v67
PubMed19064930
UniProtP80340|RL34_THET8 Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]