Structure of PDB 4v4s Chain B7

Receptor sequence
>4v4sB7 (length=46) Species: 274 (Thermus thermophilus) [Search protein sequence]
MKRTYQPNNRKRAKTHGFRARMKTKSGRNILARRRAKGRHQLTVSD
3D structure
PDB4v4s Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainB7
Resolution6.76 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B7 M1 K2 R3 T4 Y5 Q6 P7 N8 N9 R10 K11 R12 K14 H16 G17 F18 R19 M22 K25 S26 N29 I30 R34 R35 G38 R39 H40 V44 M1 K2 R3 T4 Y5 Q6 P7 N8 N9 R10 K11 R12 K14 H16 G17 F18 R19 M22 K25 S26 N29 I30 R34 R35 G38 R39 H40 V44
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4s, PDBe:4v4s, PDBj:4v4s
PDBsum4v4s
PubMed16377566
UniProtQ9RSH2|RL34_DEIRA Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]