Structure of PDB 8r08 Chain B6

Receptor sequence
>8r08B6 (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]
RLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAY
VVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKM
3D structure
PDB8r08 Structural insights into the cross-exon to cross-intron spliceosome switch
ChainB6
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B6 E16 Y22 N93 R96 E5 Y11 N82 R85
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0001825 blastocyst formation
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r08, PDBe:8r08, PDBj:8r08
PDBsum8r08
PubMed38778104
UniProtQ9Y3B4|SF3B6_HUMAN Splicing factor 3B subunit 6 (Gene Name=SF3B6)

[Back to BioLiP]