Structure of PDB 5myj Chain B6

Receptor sequence
>5myjB6 (length=44) Species: 416870 (Lactococcus cremoris subsp. cremoris MG1363) [Search protein sequence]
MKRTYQPHKKSRKTTHGFRSRMATKNGRRVLAARRRKGRASLTV
3D structure
PDB5myj A general mechanism of ribosome dimerization revealed by single-particle cryo-electron microscopy.
ChainB6
Resolution5.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B6 M1 R3 T4 Y5 Q6 P7 H8 K9 K10 S11 R12 K13 H16 G17 F18 R19 R21 K25 N26 R28 R29 V30 R34 R35 R36 K37 R39 A40 M1 R3 T4 Y5 Q6 P7 H8 K9 K10 S11 R12 K13 H16 G17 F18 R19 R21 K25 N26 R28 R29 V30 R34 R35 R36 K37 R39 A40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5myj, PDBe:5myj, PDBj:5myj
PDBsum5myj
PubMed28959045
UniProtA2RHL6|RL34_LACLM Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]