Structure of PDB 5aj4 Chain B6

Receptor sequence

>5aj4B6 (length=48) Species: 9823 (Sus scrofa)

SKTILVKMMSQAGTGFSFNTKRSRLREKLTLLHYDPVVKKKVLFVEQK

3D structure

• PDB: 5aj4 The complete structure of the 55S mammalian mitochondrial ribosome.
• Chain: B6
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B6	L17 K19 T26 F28 F30 R34 R36 R38 L43 H45 Y46	L5 K7 T14 F16 F18 R22 R24 R26 L31 H33 Y34

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 02:28:42 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5aj4', asym_id = 'B6', title = 'The complete structure of the 55S mammalian mitochondrial ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5aj4', asym_id='B6', title='The complete structure of the 55S mammalian mitochondrial ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '5aj4', asym_id = 'B6'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='5aj4', asym_id='B6')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>