Structure of PDB 4v9k Chain B6

Receptor sequence
>4v9kB6 (length=50) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
VRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI
3D structure
PDB4v9k Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainB6
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B6 V5 K8 E12 R19 T23 E24 K25 K27 T30 R37 K38 Y39 W42 K45 H46 V1 K4 E8 R15 T19 E20 K21 K23 T26 R33 K34 Y35 W38 K41 H42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9k, PDBe:4v9k, PDBj:4v9k
PDBsum4v9k
PubMed23812722
UniProtQ72GW3|RL33_THET2 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]