Structure of PDB 4v8x Chain B6

Receptor sequence
>4v8xB6 (length=50) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
VRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI
3D structure
PDB4v8x Yoeb-Ribosome Structure: A Canonical Rnase that Requires the Ribosome for its Specific Activity.
ChainB6
Resolution3.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B6 V5 K8 R19 Y21 E24 K25 N26 K27 T30 P31 E35 R37 K38 Y39 W42 K45 H46 K53 V1 K4 R15 Y17 E20 K21 N22 K23 T26 P27 E31 R33 K34 Y35 W38 K41 H42 K49
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8x, PDBe:4v8x, PDBj:4v8x
PDBsum4v8x
PubMed23945936
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]