Structure of PDB 4v7l Chain B6

Receptor sequence
>4v7lB6 (length=50) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREV
3D structure
PDB4v7l The structures of the anti-tuberculosis antibiotics viomycin and capreomycin bound to the 70S ribosome.
ChainB6
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B6 S3 R19 Y21 T23 E24 K25 K27 T30 K38 Y39 W42 K45 H46 S1 R17 Y19 T21 E22 K23 K25 T28 K36 Y37 W40 K43 H44
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7l, PDBe:4v7l, PDBj:4v7l
PDBsum4v7l
PubMed20154709
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]