Structure of PDB 4v5s Chain B6

Receptor sequence
>4v5sB6 (length=50) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
VRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI
3D structure
PDB4v5s How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.
ChainB6
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B6 V5 K8 L10 R19 Y21 K25 K27 T30 E35 R37 K38 Y39 W42 K45 I54 V1 K4 L6 R15 Y17 K21 K23 T26 E31 R33 K34 Y35 W38 K41 I50
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5s, PDBe:4v5s, PDBj:4v5s
PDBsum4v5s
PubMed21378964
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]