Structure of PDB 4v4s Chain B6

Receptor sequence
>4v4sB6 (length=53) Species: 274 (Thermus thermophilus) [Search protein sequence]
AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFR
EKK
3D structure
PDB4v4s Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainB6
Resolution6.76 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B6 A2 K3 D4 I9 K11 F20 Y22 T24 N27 R28 N30 T31 Q32 Y40 K46 H47 A1 K2 D3 I8 K10 F19 Y21 T23 N26 R27 N29 T30 Q31 Y39 K45 H46
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4s, PDBe:4v4s, PDBj:4v4s
PDBsum4v4s
PubMed16377566
UniProtQ9RSS4|RL33_DEIRA Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]