Structure of PDB 8iuf Chain B5 |
>8iufB5 (length=140) Species: 3039 (Euglena gracilis) [Search protein sequence] |
FWQAEHKVYPPSKIHPGVHKGYIRTGVVHNLMRLLAAAAAAAWAPVTALA SFATWRYRAEVAEWLDNLSNVDYPKWLAEREIAIRRVETEIFWRIEGHAQ QRSQVASGQGRAMLNKAAKASYEESEASRLHGAGVSDLLK |
|
PDB | 8iuf Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism. |
Chain | B5 |
Resolution | 2.81 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
U10 |
B5 |
P11 S12 P16 Y22 |
P11 S12 P16 Y22 |
|
|
|