Structure of PDB 6gb2 Chain B5

Receptor sequence
>6gb2B5 (length=110) Species: 9823 (Sus scrofa) [Search protein sequence]
AAPKNRRSIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHILCGYCYE
KVRKETAEIRRQMGKQEGGPFRAPTTETVVLYSGETPSEQDQGKRIIERE
RKRPSWFTQN
3D structure
PDB6gb2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
ChainB5
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B5 A79 A80 P81 K82 N83 R84 R85 S86 I87 N90 R91 C92 R93 R94 R95 N96 P97 Q98 K99 N106 H120 R131 R138 R139 F149 A1 A2 P3 K4 N5 R6 R7 S8 I9 N12 R13 C14 R15 R16 R17 N18 P19 Q20 K21 N28 H42 R53 R60 R61 F71
BS02 ZN B5 C110 C123 C126 C32 C45 C48
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 08:57:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6gb2', asym_id = 'B5', title = 'Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6gb2', asym_id='B5', title='Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0006412,0015934', uniprot = '', pdbid = '6gb2', asym_id = 'B5'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0006412,0015934', uniprot='', pdbid='6gb2', asym_id='B5')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>