Structure of PDB 5e81 Chain B5

Receptor sequence
>5e81B5 (length=94) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEG
3D structure
PDB5e81 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
ChainB5
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B5 M1 S14 K16 K25 H31 T35 K36 T37 K40 E44 K53 N55 T56 L57 H58 R60 K62 K63 K64 L66 Y69 L70 G71 K72 R73 D75 I80 M1 S14 K16 K25 H31 T35 K36 T37 K40 E44 K53 N55 T56 L57 H58 R60 K62 K63 K64 L66 Y69 L70 G71 K72 R73 D75 I80
BS02 MG B5 N41 E44 N41 E44
BS03 MG B5 E44 K50 E44 K50
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5e81, PDBe:5e81, PDBj:5e81
PDBsum5e81
PubMed26791911
UniProtQ5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]