Structure of PDB 4v73 Chain B5

Receptor sequence
>4v73B5 (length=223) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
AKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGID
ARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLA
DQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAE
AVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKP
TQAKGVYIKKVSISTTMGAGVAV
3D structure
PDB4v73 Energy barriers and driving forces in tRNA translocation through the ribosome.
ChainB5
Resolution15.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B5 R60 G132 K141 R164 R59 G131 K140 R163
BS02 rna B5 A2 K3 T5 K6 R7 R9 K37 F38 N47 D166 H172 K205 K211 S213 S215 M218 G219 G221 A1 K2 T4 K5 R6 R8 K36 F37 N46 D165 H171 K204 K210 S212 S214 M217 G218 G220
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0045947 negative regulation of translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v73, PDBe:4v73, PDBj:4v73
PDBsum4v73
PubMed24186064
UniProtP0A7L0|RL1_ECOLI Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]