Structure of PDB 4v6u Chain B5

Receptor sequence
>4v6uB5 (length=81) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
AIDVGRIAVVIAGRRAGQKVVVVDIIDKNFVLVTGAGLNKVKRRRMNIKH
IEPLPQKIDIPRGASDEEVRAALEKAGISLA
3D structure
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
ChainB5
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B5 G15 R16 K42 K44 R45 R46 R47 M48 K51 G13 R14 K40 K42 R43 R44 R45 M46 K49
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ8U2L5|RL14E_PYRFU Large ribosomal subunit protein eL14 (Gene Name=rpl14e)

[Back to BioLiP]