Structure of PDB 4v69 Chain B5

Receptor sequence

>4v69B5 (length=234) Species: 562 (Escherichia coli) [Search protein sequence]

MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGI
DARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDL
ADQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVA
EAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAK
PTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN

3D structure

PDB

4v69 Ribosome-induced changes in elongation factor Tu conformation control GTP hydrolysis

Chain

Resolution

6.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B5	R53 K54 S55 L127 G128 Q129 V130 K141	R53 K54 S55 L127 G128 Q129 V130 K141
BS02	rna	B5	M1 A2 K3 L4 K6 R7 M8 R9 V10 K14 T35 A36 K37 F38 S41 D43 R71 I104 K105 K106 G107 E108 M109 N110 D112 Q126 L127 G128 Q129 V130 L131 G132 P133 R134 G135 L136 M137 N139 R162 R164 D166 K167 N168 I170 H172 T174 K205 K211 S213 S215 T216 T217 M218 G219 G221	M1 A2 K3 L4 K6 R7 M8 R9 V10 K14 T35 A36 K37 F38 S41 D43 R71 I104 K105 K106 G107 E108 M109 N110 D112 Q126 L127 G128 Q129 V130 L131 G132 P133 R134 G135 L136 M137 N139 R162 R164 D166 K167 N168 I170 H172 T174 K205 K211 S213 S215 T216 T217 M218 G219 G221

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006417	regulation of translation
GO:0045947	negative regulation of translational initiation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v69, PDBe:4v69, PDBj:4v69
PDBsum	4v69
PubMed	19122150
UniProt	P0A7L0\|RL1_ECOLI Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]