Structure of PDB 4v67 Chain B5

Receptor sequence

>4v67B5 (length=52) Species: 274 (Thermus thermophilus)

AKHPVPKKKTSKARRDARRSHHALTPPILVPCPECKAMKPPHTVCPECGY
YA

3D structure

• PDB: 4v67 Crystal structure of a translation termination complex formed with release factor RF2.
• Chain: B5
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B5	A2 K3 H4 P5 V6 P7 K8 K9 K10 T11 S12 K13 A14 R15 R16 A18 R19 R20 S21 H22 H23 I29 P42 H43 Y51 Y52	A1 K2 H3 P4 V5 P6 K7 K8 K9 T10 S11 K12 A13 R14 R15 A17 R18 R19 S20 H21 H22 I28 P41 H42 Y50 Y51

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v67, PDBe:4v67, PDBj:4v67
• PDBsum: 4v67
• PubMed: 19064930
• UniProt: P80339|RL32_THET8 Large ribosomal subunit protein bL32 (Gene Name=rpmF)