Structure of PDB 4v63 Chain B5

Receptor sequence
>4v63B5 (length=52) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
AKHPVPKKKTSKARRDARRSHHALTPPILVPCPECKAMKPPHTVCPECGY
YA
3D structure
PDB4v63 Structural basis for translation termination on the 70S ribosome
ChainB5
Resolution3.207 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B5 A2 K3 H4 P5 V6 P7 K8 K9 K10 T11 S12 K13 R16 D17 A18 R19 R20 S21 H22 H23 I29 H43 A1 K2 H3 P4 V5 P6 K7 K8 K9 T10 S11 K12 R15 D16 A17 R18 R19 S20 H21 H22 I28 H42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v63, PDBe:4v63, PDBj:4v63
PDBsum4v63
PubMed18596689
UniProtP62652|RL32_THET2 Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]