Structure of PDB 4v4w Chain B5

Receptor sequence
>4v4wB5 (length=119) Species: 562 (Escherichia coli) [Search protein sequence]
ITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEK
TEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKD
DAEALKKALEEAGAEVEVK
3D structure
PDB4v4w Elongation arrest by SecM via a cascade of ribosomal RNA rearrangements
ChainB5
Resolution15.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B5 S24 A25 M26 E27 E28 K29 F30 S23 A24 M25 E26 E27 K28 F29
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0043022 ribosome binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4w, PDBe:4v4w, PDBj:4v4w
PDBsum4v4w
PubMed16713583
UniProtP0A7K2|RL7_ECOLI Large ribosomal subunit protein bL12 (Gene Name=rplL)

[Back to BioLiP]