Structure of PDB 4v4r Chain B5

Receptor sequence
>4v4rB5 (length=58) Species: 274 (Thermus thermophilus) [Search protein sequence]
AKHPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGY
YDGRQVLA
3D structure
PDB4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainB5
Resolution5.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B5 A2 K3 H4 P5 V6 P7 K8 K9 K10 T11 S12 K13 K15 R16 M18 R19 R20 H22 N29 T31 H43 A1 K2 H3 P4 V5 P6 K7 K8 K9 T10 S11 K12 K14 R15 M17 R18 R19 H21 N28 T30 H42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
PDBsum4v4r
PubMed16377566
UniProtP49228|RL32_DEIRA Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]