Structure of PDB 8hfr Chain B4

Receptor sequence

>8hfrB4 (length=251) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHD
SGRGAPLAKVVFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVGNV
LPLGSVPEGTIVSNVEEKPGDRGALARASGNYVIIIGHNPDENKTRVRLP
SGAKKVISSDARGVIGVIAGGGRVDKPLLKAGRAFHKYRLKRNSWPKTRG
VAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAARRTGLLRGSQK
T

3D structure

PDB

8hfr Nuclear export of pre-60S particles through the nuclear pore complex.

Chain

Resolution

2.64 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B4	G2 R3 V4 N7 Q8 R9 K10 G11 I15 T17 S18 H19 T20 R21 R23 G25 Y34 R37 Y40 I44 H50 R54 R64 Y67 K68 Y69 G85 F87 Y89 A94 S95 A125 L126 A127 R128 A129 S130 N132 L150 S152 K156 R174 K177 L179 L180 K181 A182 G183 H187 L191 R193 W196 K198 T199 R200 G201 V202 M204 N205 P206 V207 D208 H211 G213 G214 N215 H216 A222 S223 T224 I225 R227 V230 S231 Q233 K234 G236 A239 A240 R241 R242 T243 G244 L245 L246 Q250	G1 R2 V3 N6 Q7 R8 K9 G10 I14 T16 S17 H18 T19 R20 R22 G24 Y33 R36 Y39 I43 H49 R53 R63 Y66 K67 Y68 G84 F86 Y88 A93 S94 A124 L125 A126 R127 A128 S129 N131 L149 S151 K155 R173 K176 L178 L179 K180 A181 G182 H186 L190 R192 W195 K197 T198 R199 G200 V201 M203 N204 P205 V206 D207 H210 G212 G213 N214 H215 A221 S222 T223 I224 R226 V229 S230 Q232 K233 G235 A238 A239 R240 R241 T242 G243 L244 L245 Q249
BS02	MG	B4	H211 G212 G213	H210 G211 G212

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hfr, PDBe:8hfr, PDBj:8hfr
PDBsum	8hfr
PubMed	37258668
UniProt	P0CX45\|RL2A_YEAST Large ribosomal subunit protein uL2A (Gene Name=RPL2A)

[Back to BioLiP]