Structure of PDB 7nsi Chain B4 |
>7nsiB4 (length=62) Species: 9823 (Sus scrofa) [Search protein sequence] |
DCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMPVDLDS LSPEERRARFRK |
|
PDB | 7nsi Structural basis of translation termination, rescue, and recycling in mammalian mitochondria. |
Chain | B4 |
Resolution | 4.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
B4 |
R43 Q47 |
R9 Q13 |
|
|
|
|