Structure of PDB 5aj4 Chain B4

Receptor sequence
>5aj4B4 (length=45) Species: 9823 (Sus scrofa) [Search protein sequence]
DCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMP
3D structure
PDB5aj4 The complete structure of the 55S mammalian mitochondrial ribosome.
ChainB4
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna B4 R43 Q47 R9 Q13
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 05:43:05 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5aj4', asym_id = 'B4', title = 'The complete structure of the 55S mammalian mitochondrial ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5aj4', asym_id='B4', title='The complete structure of the 55S mammalian mitochondrial ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005762', uniprot = '', pdbid = '5aj4', asym_id = 'B4'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005762', uniprot='', pdbid='5aj4', asym_id='B4')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>