Structure of PDB 4v8b Chain B4 |
>4v8bB4 (length=66) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV DTEGRVERFQRRYGDS |
|
PDB | 4v8b A new understanding of the decoding principle on the ribosome. |
Chain | B4 |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
B4 |
M1 K2 |
M1 K2 |
|
|
|
|