Structure of PDB 4v6u Chain B4

Receptor sequence
>4v6uB4 (length=123) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKL
VIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVA
IIEPGKARDLVEEIAMKVKELMK
3D structure
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
ChainB4
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B4 K34 G35 T36 N37 E38 K41 V57 D58 I62 K83 I92 E93 V94 A97 K34 G35 T36 N37 E38 K41 V57 D58 I62 K83 I92 E93 V94 A97
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ8U160|RL7A_PYRFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]