Structure of PDB 4v4y Chain B4

Receptor sequence
>4v4yB4 (length=57) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
HPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYYA
GRKVLEV
3D structure
PDB4v4y Structural basis for messenger RNA movement on the ribosome.
ChainB4
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna B4 H4 P5 V6 P7 K8 K9 K10 T11 S12 K13 R15 R16 D17 A18 R19 R20 S21 H22 H23 T29 V31 K40 P42 H43 Y52 H1 P2 V3 P4 K5 K6 K7 T8 S9 K10 R12 R13 D14 A15 R16 R17 S18 H19 H20 T26 V28 K37 P39 H40 Y49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
PDBsum4v4y
PubMed17051149
UniProtP80339|RL32_THET8 Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]