Structure of PDB 4v4r Chain B4

Receptor sequence

>4v4rB4 (length=73) Species: 274 (Thermus thermophilus)

MQKDLHPKAVPCKIIYQGQVVMETMSTRPEIHVDVWSGVHPFWTGEERFL
DTEGRVDKFNKRFGDSYRRGSKK

3D structure

• PDB: 4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
• Chain: B4
• Resolution: 5.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B4	M22 T27 R28	M22 T27 R28
BS02	rna	B4	M1 Q2 K3 K8 V10 C12 I15 Y16 E23 T24 T27 R28 P29 E30 I31 H32 V33 D34 V35 W36 G38 V39 H40 P41 F42 W43 R55 K58 F59 R62 F63 R69	M1 Q2 K3 K8 V10 C12 I15 Y16 E23 T24 T27 R28 P29 E30 I31 H32 V33 D34 V35 W36 G38 V39 H40 P41 F42 W43 R55 K58 F59 R62 F63 R69

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
• PDBsum: 4v4r
• PubMed: 16377566
• UniProt: Q9RW44|RL31_DEIRA Large ribosomal subunit protein bL31 (Gene Name=rpmE)