Structure of PDB 3j9w Chain B4

Receptor sequence
>3j9wB4 (length=54) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
AVPFRRTSKMKKRLRRTHFKLNVPGMTECPSCGEMKLSHRVCKACGSYNG
KDIN
3D structure
PDB3j9w Structure of the Bacillus subtilis 70S ribosome reveals the basis for species-specific stalling.
ChainB4
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B4 A2 V3 P4 F5 R6 R7 T8 S9 K10 M11 K13 R14 L15 R16 R17 T18 H19 F20 K21 T28 K37 S39 H40 R41 Y49 N50 A1 V2 P3 F4 R5 R6 T7 S8 K9 M10 K12 R13 L14 R15 R16 T17 H18 F19 K20 T27 K36 S38 H39 R40 Y48 N49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j9w, PDBe:3j9w, PDBj:3j9w
PDBsum3j9w
PubMed25903689
UniProtO34687|RL32_BACSU Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]