Structure of PDB 4w29 Chain B3

Receptor sequence
>4w29B3 (length=60) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKV
AHLVRVEVVE
3D structure
PDB4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
ChainB3
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B3 K10 S11 I13 G14 D18 A21 K24 A25 R29 R30 L31 Q32 A42 I43 G45 N46 K49 K10 S11 I13 G14 D18 A21 K24 A25 R29 R30 L31 Q32 A42 I43 G45 N46 K49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w29, PDBe:4w29, PDBj:4w29
PDBsum4w29
PubMed25190797
UniProtQ72I22|RL30_THET2 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]