Structure of PDB 4v9m Chain B3

Receptor sequence
>4v9mB3 (length=60) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKV
AHLVRVEVVE
3D structure
PDB4v9m Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainB3
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B3 S11 I13 Y15 K17 A21 K24 A25 R29 R30 L31 Q32 P41 A42 G45 N46 K49 S11 I13 Y15 K17 A21 K24 A25 R29 R30 L31 Q32 P41 A42 G45 N46 K49
BS02 rna B3 K10 P16 Q19 H52 K10 P16 Q19 H52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9m, PDBe:4v9m, PDBj:4v9m
PDBsum4v9m
PubMed23812722
UniProtQ72I22|RL30_THET2 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]