Structure of PDB 4v9b Chain B3

Receptor sequence

>4v9bB3 (length=76) Species: 300852 (Thermus thermophilus HB8)

TRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTL
FALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4v9b Structural basis for potent inhibitory activity of the antibiotic tigecycline during protein synthesis.
• Chain: B3
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B3	T10 R11 N12 R14 D15 S16 Q17 A18 K19 R20 K24 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 G54 R55 D56 F57 T58 F60 F69 R74 R77	T1 R2 N3 R5 D6 S7 Q8 A9 K10 R11 K15 Y17 E18 Q20 R23 A24 G25 N26 I27 R30 R32 G33 T34 G45 R46 D47 F48 T49 F51 F60 R65 R68
BS02	rna	B3	R72 R74	R63 R65

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9b, PDBe:4v9b, PDBj:4v9b
• PDBsum: 4v9b
• PubMed: 23431179
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)