Structure of PDB 4v83 Chain B3

Receptor sequence
>4v83B3 (length=44) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
LLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREV
3D structure
PDB4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.
ChainB3
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B3 R19 Y21 E24 K25 K27 T30 N32 R37 Y39 W42 K45 H46 R11 Y13 E16 K17 K19 T22 N24 R29 Y31 W34 K37 H38
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v83, PDBe:4v83, PDBj:4v83
PDBsum4v83
PubMed21245352
UniProtQ72GW3|RL33_THET2 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]