Structure of PDB 4v7p Chain B3

Receptor sequence
>4v7pB3 (length=44) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
LLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREV
3D structure
PDB4v7p Recognition of the amber UAG stop codon by release factor RF1.
ChainB3
Resolution3.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna B3 R19 T23 E24 K25 K27 T30 N32 E35 R37 K38 Y39 W42 H46 R11 T15 E16 K17 K19 T22 N24 E27 R29 K30 Y31 W34 H38
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v7p, PDBe:4v7p, PDBj:4v7p
PDBsum4v7p
PubMed20588254
UniProtQ72GW3|RL33_THET2 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]